Web Analysis for Addar-Hotel - addar-hotel.com
2.50
Rating by CuteStat
addar-hotel.com is 2 decades 4 years old. It is a domain having com extension. It has a global traffic rank of #6524231 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, addar-hotel.com is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | 129 |
Daily Pageviews: | 258 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | 34 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 50,900 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 6,524,231 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 3 |
H3 Headings: | 5 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 12 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 192.254.189.17)
"Meee WOW" | New: Supplement that Reduces Stool Odor..... It's Purrr F
- meeewow.com
Not Applicable
$
8.95
Get Auto Commissions Review - Unlimited Autopilot Solution?
- autocommissions.org
Is get auto commissions the answer to real autopilot profits online? Or are Dave and Diana Daniels scams? Find out the truth in my in-depth review.
4,595,301
$
240.00
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sat, 14 Dec 2019 15:10:40 GMT
Server: Apache
Link: <http://www.addar-hotel.com/?rest_route=/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 4678
Content-Type: text/html; charset=UTF-8
Date: Sat, 14 Dec 2019 15:10:40 GMT
Server: Apache
Link: <http://www.addar-hotel.com/?rest_route=/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 4678
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns2239.hostgator.com | 192.254.189.158 | United States of America | |
ns2240.hostgator.com | 192.254.189.159 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
addar-hotel.com | A | 10800 |
IP: 192.254.189.17 |
addar-hotel.com | NS | 86400 |
Target: ns2240.hostgator.com |
addar-hotel.com | NS | 86400 |
Target: ns2239.hostgator.com |
addar-hotel.com | SOA | 10800 |
MNAME: ns6365.hostgator.com RNAME: dnsadmin.gator3183.hostgator.com Serial: 2018060800 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
addar-hotel.com | MX | 14400 |
Target: addar-hotel.com |
addar-hotel.com | TXT | 14400 |
TXT: v=spf1 ip4:184.173.239.119 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites
Traders of the Lost Art, Inc. Inspirational gifts store
- tradersofthelostartinc.com
6,524,236
$
240.00
Jess Ainscough - The Wellness Warrior
- jessainscough.com
The Wellness Warrior | Be kind. Be brave. Be well.
6,524,237
$
240.00
trustme.business — Coming Soon
- trustme.business
This is a default index page for a new domain.
6,524,240
$
240.00
Fat Diminisher System eBook Review By Wesley Virgin
- fatdiminishersystemreviewpdf.com
Today i am going to show you Fat Diminisher System eBook Review By Wesly Virgin in a detail. What actually the program is all about and does it really work?
6,524,247
$
8.95
Full WHOIS Lookup
Domain Name: ADDAR-HOTEL.COM
Registry Domain ID: 10213343_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2017-08-28T02:41:33Z
Creation Date: 1999-09-15T13:33:34Z
Registrar Registration Expiration Date: 2024-09-15T13:33:34Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: PERFECT PRIVACY, LLC
Registrant Organization:
Registrant Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32256
Registrant Country: US
Registrant Phone: +1.5707088780
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: ps7vy8eu9h6@networksolutionsprivateregistration.com
Registry Admin ID:
Admin Name: PERFECT PRIVACY, LLC
Admin Organization:
Admin Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32256
Admin Country: US
Admin Phone: +1.5707088780
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: ps7vy8eu9h6@networksolutionsprivateregistration.com
Registry Tech ID:
Tech Name: PERFECT PRIVACY, LLC
Tech Organization:
Tech Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Tech City: Jacksonville
Tech State/Province: FL
Tech Postal Code: 32256
Tech Country: US
Tech Phone: +1.5707088780
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: qf7du8bn4tm@networksolutionsprivateregistration.com
Name Server: NS2239.HOSTGATOR.COM
Name Server: NS2240.HOSTGATOR.COM
DNSSEC: unsigned
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8003337680
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-14T15:10:44Z <<<
For more information on Whois status codes, please visit https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
This listing is a Network Solutions Private Registration. Mail
correspondence to this address must be sent via USPS Express Mail(TM) or
USPS Certified Mail(R); all other mail will not be processed. Be sure to
include the registrant's domain name in the address.
The data in Networksolutions.com's WHOIS database is provided to you by
Networksolutions.com for information purposes only, that is, to assist you in
obtaining information about or related to a domain name registration
record. Networksolutions.com makes this information available "as is," and
does not guarantee its accuracy. By submitting a WHOIS query, you
agree that you will use this data only for lawful purposes and that,
under no circumstances will you use this data to: (1) allow, enable,
or otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via direct mail, electronic mail, or by
telephone; or (2) enable high volume, automated, electronic processes
that apply to Networksolutions.com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of Networksolutions.com.
Networksolutions.com reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.
For more information on Whois status codes, please visit
https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
Registry Domain ID: 10213343_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2017-08-28T02:41:33Z
Creation Date: 1999-09-15T13:33:34Z
Registrar Registration Expiration Date: 2024-09-15T13:33:34Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: PERFECT PRIVACY, LLC
Registrant Organization:
Registrant Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32256
Registrant Country: US
Registrant Phone: +1.5707088780
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: ps7vy8eu9h6@networksolutionsprivateregistration.com
Registry Admin ID:
Admin Name: PERFECT PRIVACY, LLC
Admin Organization:
Admin Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32256
Admin Country: US
Admin Phone: +1.5707088780
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: ps7vy8eu9h6@networksolutionsprivateregistration.com
Registry Tech ID:
Tech Name: PERFECT PRIVACY, LLC
Tech Organization:
Tech Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Tech City: Jacksonville
Tech State/Province: FL
Tech Postal Code: 32256
Tech Country: US
Tech Phone: +1.5707088780
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: qf7du8bn4tm@networksolutionsprivateregistration.com
Name Server: NS2239.HOSTGATOR.COM
Name Server: NS2240.HOSTGATOR.COM
DNSSEC: unsigned
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8003337680
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-14T15:10:44Z <<<
For more information on Whois status codes, please visit https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
This listing is a Network Solutions Private Registration. Mail
correspondence to this address must be sent via USPS Express Mail(TM) or
USPS Certified Mail(R); all other mail will not be processed. Be sure to
include the registrant's domain name in the address.
The data in Networksolutions.com's WHOIS database is provided to you by
Networksolutions.com for information purposes only, that is, to assist you in
obtaining information about or related to a domain name registration
record. Networksolutions.com makes this information available "as is," and
does not guarantee its accuracy. By submitting a WHOIS query, you
agree that you will use this data only for lawful purposes and that,
under no circumstances will you use this data to: (1) allow, enable,
or otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via direct mail, electronic mail, or by
telephone; or (2) enable high volume, automated, electronic processes
that apply to Networksolutions.com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of Networksolutions.com.
Networksolutions.com reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.
For more information on Whois status codes, please visit
https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.