2.50 Rating by CuteStat

addar-hotel.com is 2 decades 4 years old. It is a domain having com extension. It has a global traffic rank of #6524231 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, addar-hotel.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 129
Daily Pageviews: 258

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 34
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 50,900
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,524,231
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.189.17

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 3
H3 Headings: 5 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.254.189.17)

Home page

- sitebucket.net

Default Description

Not Applicable $ 8.95


Your Store

- smykker2you.com

My Store

Not Applicable $ 8.95

Index of /

- jcdesignandprint.com
Not Applicable $ 8.95

Get Auto Commissions Review - Unlimited Autopilot Solution?

- autocommissions.org

Is get auto commissions the answer to real autopilot profits online? Or are Dave and Diana Daniels scams? Find out the truth in my in-depth review.

4,595,301 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 14 Dec 2019 15:10:40 GMT
Server: Apache
Link: <http://www.addar-hotel.com/?rest_route=/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 4678
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Network Solutions, LLC
Registration Date: Sep 15, 1999, 7:18 PM 2 decades 4 years 7 months ago
Expiration Date: Sep 15, 2024, 7:18 PM 4 months 6 days 29 minutes from now
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns2239.hostgator.com 192.254.189.158 United States of America United States of America
ns2240.hostgator.com 192.254.189.159 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
addar-hotel.com A 10800 IP: 192.254.189.17
addar-hotel.com NS 86400 Target: ns2240.hostgator.com
addar-hotel.com NS 86400 Target: ns2239.hostgator.com
addar-hotel.com SOA 10800 MNAME: ns6365.hostgator.com
RNAME: dnsadmin.gator3183.hostgator.com
Serial: 2018060800
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
addar-hotel.com MX 14400 Target: addar-hotel.com
addar-hotel.com TXT 14400 TXT: v=spf1 ip4:184.173.239.119 a mx
include:websitewelcome.com ~all

Similarly Ranked Websites

Traders of the Lost Art, Inc. Inspirational gifts store

- tradersofthelostartinc.com
6,524,236 $ 240.00

Jess Ainscough - The Wellness Warrior

- jessainscough.com

The Wellness Warrior | Be kind. Be brave. Be well.

6,524,237 $ 240.00

trustme.business — Coming Soon

- trustme.business

This is a default index page for a new domain.

6,524,240 $ 240.00

Fat Diminisher System eBook Review By Wesley Virgin

- fatdiminishersystemreviewpdf.com

Today i am going to show you Fat Diminisher System eBook Review By Wesly Virgin in a detail. What actually the program is all about and does it really work?

6,524,247 $ 8.95

Welcome - Mathematical Association of NSW Inc.

- mansw.nsw.edu.au
6,524,256 $ 240.00

Full WHOIS Lookup

Domain Name: ADDAR-HOTEL.COM
Registry Domain ID: 10213343_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2017-08-28T02:41:33Z
Creation Date: 1999-09-15T13:33:34Z
Registrar Registration Expiration Date: 2024-09-15T13:33:34Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: PERFECT PRIVACY, LLC
Registrant Organization:
Registrant Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32256
Registrant Country: US
Registrant Phone: +1.5707088780
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: ps7vy8eu9h6@networksolutionsprivateregistration.com
Registry Admin ID:
Admin Name: PERFECT PRIVACY, LLC
Admin Organization:
Admin Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32256
Admin Country: US
Admin Phone: +1.5707088780
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: ps7vy8eu9h6@networksolutionsprivateregistration.com
Registry Tech ID:
Tech Name: PERFECT PRIVACY, LLC
Tech Organization:
Tech Street: 5335 Gate Parkway care of Network Solutions PO Box 459
Tech City: Jacksonville
Tech State/Province: FL
Tech Postal Code: 32256
Tech Country: US
Tech Phone: +1.5707088780
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: qf7du8bn4tm@networksolutionsprivateregistration.com
Name Server: NS2239.HOSTGATOR.COM
Name Server: NS2240.HOSTGATOR.COM
DNSSEC: unsigned
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8003337680
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-14T15:10:44Z <<<

For more information on Whois status codes, please visit https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en


This listing is a Network Solutions Private Registration. Mail
correspondence to this address must be sent via USPS Express Mail(TM) or
USPS Certified Mail(R); all other mail will not be processed. Be sure to
include the registrant's domain name in the address.

The data in Networksolutions.com's WHOIS database is provided to you by
Networksolutions.com for information purposes only, that is, to assist you in
obtaining information about or related to a domain name registration
record. Networksolutions.com makes this information available "as is," and
does not guarantee its accuracy. By submitting a WHOIS query, you
agree that you will use this data only for lawful purposes and that,
under no circumstances will you use this data to: (1) allow, enable,
or otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via direct mail, electronic mail, or by
telephone; or (2) enable high volume, automated, electronic processes
that apply to Networksolutions.com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of Networksolutions.com.
Networksolutions.com reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.

For more information on Whois status codes, please visit
https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.